HORDB

ID: hor006107
Uniprot ID: P04808
Protein name: Relaxin B chain
Gene name: RLN1
Organism: Homo sapiens (Human)
Family: Insulin family
Source: Human
Expression: Prostate. Not expressed in placenta, decidua or ovary.
Disease: Diseases associated with RLN1 include Spermatogenic Failure 8 and Extragonadal Germ Cell Cancer.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0007165 signal transduction; GO:0007565 female pregnancy
GO CC: GO:0005576 extracellular region

Sequence: VAAKWKDDVIKLCGRELVRAQIAICGMSTWS
Length: 31
Propeptide: MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC
Signal peptide: MPRLFLFHLLEFCLLLNQFSRA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
Mechanism: NA
Cross BBB: NA
Target: RXFP2, RXFP1
Target Unid: Q8WXD0, Q9HBX9
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006107_AF2.pdb

hor006107_ESM.pdb

Mass:	398443	Formula:	C152H251N43O42S3
Absent amino acids:	FHNPY	Common amino acids:	A
pI:	8.81	Basic residues:	5
Polar residues:	7	Hydrophobic residues:	14
Hydrophobicity:	26.45	Boman Index:	-3024
Half-Life:	100 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	103.87
Instability Index:	1352.58	Extinction Coefficient cystines:	11125
Absorbance 280nm:	370.83

PubMed ID: 6548702
Title: Relaxin gene expression in human ovaries and the predicted structure of a human preprorelaxin by analysis of cDNA clones.
PubMed ID: 6298628
Title: Structure of a genomic clone encoding biologically active human relaxin.
PubMed ID: 15164053
Title: DNA sequence and analysis of human chromosome 9.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 8735594
Title: Expression of human relaxin genes: characterization of a novel alternatively-spliced human relaxin mRNA species.
PubMed ID: 10601981
Title: Analysis of the 5'-upstream regions of the human relaxin H1 and H2 genes and their chromosomal localization on chromosome 9p24.1 by radiation hybrid and breakpoint mapping.